Home » Authors » Laure Guilhaudis, Taylor Cunning, Jack Delaney, Nigel Ternan, Milena Mechkarska, Samir Attoub, J. Michael Conlon

Laure Guilhaudis, Taylor Cunning, Jack Delaney, Nigel Ternan, Milena Mechkarska, Samir Attoub, J. Michael Conlon

Public reference bibliography and cataloged PDF materials authored or published by Laure Guilhaudis, Taylor Cunning, Jack Delaney, Nigel Ternan, Milena Mechkarska, Samir Attoub, J. Michael Conlon.

Found 1 document(s) Page 1 of 1

Substitution of a proline residue in the frog skin host-defense peptide, figainin-2PL by D-lysine generates an analog with potent activity against antibiotic-resistant ESKAPE pathogens

Year: 2025 • Source: hal.science • Listed PDF

Figainin-2PL (FLGTVLKLGKAIAKTVVPMLTNAMQPKQ.NH2) is active against a range of antibiotic-resistant bacteria as well as human tumor-derived cells. The study aimed to determine the effects of a proline-substitution on the b...